PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G07660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family Nin-like
Protein Properties Length: 951aa    MW: 103789 Da    PI: 5.8952
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G07660.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.61.2e-28603654152
           RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      aek+isl++l++yFs+++k+AAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  LPERR01G07660.1 603 AEKTISLDVLQQYFSGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 654
                      589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.541593674IPR003035RWP-RK domain
PfamPF020426.6E-26606654IPR003035RWP-RK domain
SuperFamilySSF542775.89E-21847942No hitNo description
PfamPF005643.0E-15857938IPR000270PB1 domain
SMARTSM006662.8E-24857939IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2406.6E-25857938No hitNo description
PROSITE profilePS5174518.316857939IPR000270PB1 domain
CDDcd064071.63E-32858938No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 951 aa     Download sequence    Send to blast
MEVDPPSSSA GMGGEGAGAG ELWPFDSLTT SLLFSSVSSS PPLPPLPASS SSWLTPPSPL  60
WLFDERQQLP LDMGPAVSGG AAAAVAAPTP EAAVAAAVVD EVNRTRSGNS DTTSKRVEHI  120
NSKWQFHLSL DDNTDSASLF KERLTQALRY FKESTDQHLL VQVWAPVKNG DRYVLTTSGQ  180
PFVLDQQSIG LLQYRAVSMM YMFSVDGENA GELGLPGRVY KQKVPEWTPN VQYYSSTEYP  240
RLNHAISYNV HGTVALPVFD PSVQSCIAVV ELIMTSKKIN YAGEVDKVCK ALEAVNLKST  300
EILDHPNVQI CNEGRQSALV EILEILTVVC EEHKLPLAQT WVPCKYRSVL AHGGGVKKSC  360
LSFDGSCMGE VCMSTSDVAF HVIDARMWGF RDACVEHHLQ KGQGVSGKAF IYRRPCFSKD  420
ISQFCKLEYP LVHYARMFGL AGCFAICLQS LYTGDDDYIL EFFLPPNCRN EDDQNALLGS  480
ILARVKRCLR SLKVVGNGDS NEICLQISNV LMIENEDLKT NVHLENSEGC FRESPEGNAS  540
HRDHEVVDND DNKVSTMSER NLLADDNSQN NGASAGRPNG SNASDSSLLH KSNKPPERRR  600
GKAEKTISLD VLQQYFSGSL KNAAKSLGVC PTTMKRICRQ HGISRWPSRK INKVNRSLSK  660
LKQVIESVQG SDAAFNLTSI TGPLPIPVGP SSDSQNIEKS SPNKVAELSN LAVEGDRDSS  720
LQKPLENDSN LAMLMSQQGF IDANNNLQLE ADKASHSRSS SGEGSINSRT SEASCQGSPA  780
NQTFVCQPIA STFVEPPQLI PEGFTKEPFQ EPALPLSRML IEDSGSSKDL KNLFASAVDQ  840
PFLTRSSNLG LMQNSGTVTI KASFKEDIVR FRFPCSGSVT ALKDEVAKRL RMDVGIFNIK  900
YLDDDHEWVK LACNADLEEC MEISRHSGSH VIRLLVSDIA AHLGSSCGSS G
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0673190.0AK067319.1 Oryza sativa Japonica Group cDNA clone:J013106K21, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613020.10.0PREDICTED: protein NLP3
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLA0A0D9UYK20.0A0A0D9UYK2_9ORYZ; Uncharacterized protein
STRINGORGLA01G0077900.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein